CXX1_HUMAN   O15255


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15255

Recommended name:CAAX box protein 1

EC number:

Alternative names:(Cerebral protein 5)

Cleaved into:

GeneID:

Gene names  (primary ):RTL8C

Gene names  (synonym ):CXX1 FAM127A MAR8 MAR8C MART8

Gene names  (ORF ):hucep-5

Length:209

Mass:22278

Sequence:MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:9403077}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp