PORIM_HUMAN Q8N131
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N131
Recommended name：Porimin
EC number：
Alternative names：(Keratinocytes-associated transmembrane protein 3) (KCT-3) (Pro-oncosis receptor inducing membrane injury) (Transmembrane protein 123)
Cleaved into：
GeneID：114908
Gene names (primary )：TMEM123
Gene names (synonym )：KCT3
Gene names (ORF )：PSEC0111 UNQ641/PRO1271
Length：208
Mass：21531
Sequence：MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII
Tissue specificity：Ubiquitous. Not expressed in ovary. Expressed in keratinocytes. {ECO:0000269|PubMed:11481458, ECO:0000269|PubMed:12752121}.
Induction：
Developmental stage：
Protein families：CD164 family