PAQR9_HUMAN Q6ZVX9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6ZVX9
Recommended name：Membrane progestin receptor epsilon
EC number：
Alternative names：(mPR epsilon) (Membrane progesterone P4 receptor epsilon) (Membrane progesterone receptor epsilon) (Progesterone and adipoQ receptor family member 9) (Progestin and adipoQ receptor family member 9) (Progestin and adipoQ receptor family member IX)
Cleaved into：
GeneID：344838
Gene names (primary )：PAQR9
Gene names (synonym )：
Gene names (ORF )：
Length：377
Mass：42692
Sequence：MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYRALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTVGYMLLLVVCLGLVIRKFLNSSEFCSKK
Tissue specificity：Expression levels vary widely in a range of tissues (PubMed:16044242). Expressed in the brain, at high level in the pituitary gland and also in hypothalamus, limbic system, caudate nucleus accumens, pons and olfactory bulb (PubMed:23161870). {ECO:0000269|PubMed:16044242, ECO:0000269|PubMed:23161870}.
Induction：
Developmental stage：
Protein families：ADIPOR family