PILRB_MOUSE Q2YFS2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2YFS2
Recommended name:Paired immunoglobulin-like type 2 receptor beta
EC number:
Alternative names:(Activating receptor PILR-beta) (Cell surface receptor FDFACT)
Cleaved into:
GeneID:170741
Gene names (primary ):Pilrb
Gene names (synonym ):Fdfact Pilrb1
Gene names (ORF ):
Length:224
Mass:25200
Sequence:MALLISLPGGTPAMAQVLLLLSSGCLHAGNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLGAMVTMLLAKVLVIVLVYGWMIFLRWKQRPAH
Tissue specificity:Widely expressed with highest levels in spleen, liver and lung. Predominantly expressed by natural killer cells, macrophages, and granulocytes and dendritic cells (BM-DC). {ECO:0000269|PubMed:14970179}.
Induction:
Developmental stage:
Protein families: