OTX2_RAT   Q64201


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64201

Recommended name:Homeobox protein OTX2

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Otx2

Gene names  (synonym ):

Gene names  (ORF ):

Length:70

Mass:7,139

Sequence:MTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGAS

Tissue specificity:Up-regulated by FGF2 treatment in embryonic telencephalon primary cultures. 1

Induction:

Developmental stage:Expressed in the dorsal and basal telencephalon, in a subpopulation of proliferating neuroblasts, early in development (at least from 11.5 dpc). 1

Protein families:


   💬 WhatsApp