ZN683_MOUSE I7HJS4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:I7HJS4
Recommended name：Tissue-resident T-cell transcription regulator protein ZNF683
EC number：
Alternative names：(Homolog of Blimp-1 in T-cell) (Hobit) (Zinc finger protein 683)
Cleaved into：
GeneID：
Gene names (primary )：Znf683
Gene names (synonym )：Gm13060 Zfp683
Gene names (ORF )：
Length：458
Mass：50419
Sequence：MKALDGLRESLYPSLDFQLYQDDQVCSADASQPLADSVGAHDLAWSERMCPLPLAPAKSPLLACPESPDLCLCALQKTPLGRAPQDLGEDASNMRHQPPSLYKASTDSEKLTIKDSLNREEMGNEPERGAYPHLPPRTSSFPDAGLDRKSLSPLTFWPWLPPTLISKEPPIHIYPIFPGYPLLPLPYLFTYGALPSAQHPYLFMLPPHSTYPTVAGPSLLMTASGSGPRIPQEKTLLLHSGAFQSAGHTLHSQVESRSSRDTRTPGQAGVAAPTRRAVPGSRAGVIALPYPLKKENGKILYECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTHLRLHSGAKPSQCGLCPSYLTPNVYPKLHHRLRAPQLRGLTHTHLPLASLTCLAQWHQGALDLVEKKMGWTVDKVSSESKGKQG
Tissue specificity：Expressed in tissue-resident memory T (Trm) cell population in non-lymphoid organs, such as skin and gut (PubMed:27102484). Expressed in innate lymphocytes, including tissue-resident natural killer (trNK) and natural killer T (NKT) cells in thymus, spleen and liver (PubMed:22885984, PubMed:27102484). {ECO:0000269|PubMed:22885984, ECO:0000269|PubMed:27102484}.
Induction：Up-regulated by interleukin IL15 in a TBX21/T-bet-dependent manner in tissue-resident memory T (Trm) cell population (PubMed:27102484). Up-regulated during the differentiation of natural killer T (NKT) cells (PubMed:22885984). Down-regulated in NKT cells after antigenic stimulation (PubMed:22885984). {ECO:0000269|PubMed:22885984, ECO:0000269|PubMed:27102484}.; (Microbial infection) Up-regulated in response to Herpes simplex virus (HSV) infection in skin CD8(+) tissue-resident memory T (Trm) cells, but not in spleen. {ECO:0000269|PubMed:27102484}.; (Microbial infection) Up-regulated in response to choriomeningitis virus (LCMV) infection in gut CD8(+) tissue-resident memory T (Trm) cells. {ECO:0000269|PubMed:27102484}.
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family