BST2_MOUSE Q8R2Q8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2Q8
Recommended name：Bone marrow stromal antigen 2
EC number：
Alternative names：(BST-2) (HM1.24 antigen) (CD antigen CD317)
Cleaved into：
GeneID：69550
Gene names (primary )：Bst2
Gene names (synonym )：
Gene names (ORF )：
Length：172
Mass：19152
Sequence：MAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVVTLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSSLLVLKVSLFLLF
Tissue specificity：In naive mice, specifically expressed on type I interferon-producing cells (at protein level). {ECO:0000269|PubMed:16920966}.
Induction：By viral or other interferon-inducing stimulation in most cell types (at protein level). Down-regulated by ebola virus GP protein. {ECO:0000269|PubMed:16920966, ECO:0000269|PubMed:19179289}.
Developmental stage：
Protein families：