TSPO_MOUSE P50637
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50637
Recommended name：Translocator protein
EC number：
Alternative names：(Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)
Cleaved into：
GeneID：12257
Gene names (primary )：Tspo
Gene names (synonym )：Bzrp Mbr
Gene names (ORF )：
Length：169
Mass：18841
Sequence：MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Tissue specificity：Detected in liver (at protein level). Ubiquitous. {ECO:0000269|PubMed:24174323, ECO:0000269|PubMed:24936060}.
Induction：By dimethyl sulfoxide and diazepam. {ECO:0000269|PubMed:8125973}.
Developmental stage：
Protein families：TspO/BZRP family