PLAG1_RAT   Q5U2T6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5U2T6

Recommended name:Zinc finger protein PLAG1

EC number:

Alternative names:

Cleaved into:

GeneID:297804

Gene names  (primary ):Plag1

Gene names  (synonym ):

Gene names  (ORF ):

Length:499

Mass:55,640

Sequence:MATVIPGDLSEVRDTQKAPSGKRKRGESKPRKNFPCQLCDKAFNSVEKLKVHSFSHTGERPYKCTHQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCERRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSTHQMITTLPLGMTCPIDMDTVHPSHHLAFKCPFSSTSYAISIPEKEQPLKGEIESYLMELQGGAPSSSQDSQASSSKLGLEPQSGSPDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQDEAHSSVSQLPTQTQDLQDPANTVGLGSLHSLSAAFTSSLSSSTTLPRFHQAFQ

Tissue specificity:Expressed in heart, spleen, lung, kidney, brain, testis and epididymis but not in salivary glands.

Induction:

Developmental stage:

Protein families:krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp