FRAT1_MOUSE   P70339


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70339

Recommended name:Proto-oncogene FRAT1

EC number:

Alternative names:(Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1)

Cleaved into:

GeneID:14296

Gene names  (primary ):Frat1

Gene names  (synonym ):

Gene names  (ORF ):

Length:274

Mass:28875

Sequence:MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDQLIVQIGETLQLDAAHDRPASPCAAPGPPPPQVLAALPADKTGTPARRLLRPTGSAETGNPAPPGAVRCVLGERGRVRGRSAPYCVAEISPGASALPQQPGLDGPPGTGKLSTPQPLSGPCRRGWLRNAAASRRLQQRRGSQPETRTGDDDDPHRLLQQLVLSGNLIKEAVRRLHSRQLQLHAKLPAHPFLGPLSAPVHEPPSPGSPRAACSDPGAFMGRAQLRTGDDLLVPGS

Tissue specificity:Highly expressed in testis. Lower level of expression in spleen, thymus and brain.

Induction:

Developmental stage:Expressed at low levels during embryonic development.

Protein families:GSK-3-binding protein family


   💬 WhatsApp