DFB15_MOUSE Q8R2I5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2I5
Recommended name：Beta-defensin 15
EC number：
Alternative names：(BD-15) (mBD-15) (Defensin, beta 15)
Cleaved into：
GeneID：246082
Gene names (primary )：Defb15
Gene names (synonym )：
Gene names (ORF )：
Length：79
Mass：8730
Sequence：MKTFLFLFAVLFFLDPAKNAFFDEKCSRVNGRCTASCLKNEELVALCQKNLKCCVTVQPCGKSKSNQSDEGSGHMGTWG
Tissue specificity：Expressed in testis and to a lesser extent in epididymis (caput, corpus and cauda). Also weakly expressed in kidneys and colon. {ECO:0000269|PubMed:14718547}.
Induction：
Developmental stage：
Protein families：Beta-defensin family