RS27A_RAT P62982
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62982
Recommended name：Ubiquitin-ribosomal protein eS31 fusion protein Curated
EC number：
Alternative names：Ubiquitin Small ribosomal subunit protein eS31 Curated Alternative names: 40S ribosomal protein S27a
Cleaved into：
GeneID：100912032
Gene names (primary )：Rps27a
Gene names (synonym )：Uba80, Ubcep1
Gene names (ORF )：
Length：156
Mass：17,951
Sequence：MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
Tissue specificity：
Induction：
Developmental stage：
Protein families：eukaryotic ribosomal protein eS31 family