MSX2_MOUSE   Q03358


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03358

Recommended name:Homeobox protein MSX-2

EC number:

Alternative names:(Homeobox protein Hox-8-1)

Cleaved into:

GeneID:17702

Gene names  (primary ):Msx2

Gene names  (synonym ):Hox-8.1 Msx-2

Gene names  (ORF ):

Length:267

Mass:28915

Sequence:MASPTKGGDLFSSDEEGPAVLAGPGPGPGGAEGSAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS

Tissue specificity:Expressed in mesenchymal tissue in the developing spinal cord and limbs.

Induction:Up-regulated by BMP2. {ECO:0000269|PubMed:15383550}.

Developmental stage:

Protein families:Msh homeobox family


   💬 WhatsApp