SRR_RAT Q76EQ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q76EQ0
Recommended name：Serine racemase
EC number：EC:5.1.1.18
Alternative names：D-serine ammonia-lyase D-serine dehydratase (EC:4.3.1.18 By Similarity) . EC:4.3.1.18 (UniProtKB | ENZYME | Rhea) By Similarity L-serine ammonia-lyase L-serine dehydratase (EC:4.3.1.17 By Similarity) . EC:4.3.1.17 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：303306
Gene names (primary )：Srr
Gene names (synonym )：
Gene names (ORF )：
Length：333
Mass：35,693
Sequence：MCAQYCISFADVEKAHLNIQDSVHLTPVLTSSILNQIAGRNLFFKCELFQKTGSFKIRGALNAIRGLIPDTLEGKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPNCKKLAIQAYGASIVYSEPSDESRENVAQRIIQETEGILVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMVAGIAITIKTLKPSVKVYAAEPSNADDCYQSKLKGELTPNLHPPETIADGVKSSIGLNTWPIIRDLVDDVFTVTEDEIKYATQLVWERMKLLIEPTAGVGLAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSLSWVKQAERPAP
Tissue specificity：Expressed in the cerebellum and frontal cortex (at protein level). 1
Induction：
Developmental stage：Not induced further in the cerebellum or frontal cortex following two weeks of intraperitoneal injections of the antipsychotic haloperidol. 1
Protein families：