CEBPB_RAT   P21272


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21272

Recommended name:CCAAT/enhancer-binding protein beta Imported

EC number:

Alternative names:C/EBP-related protein 2 Interleukin-6-dependent-binding protein (IL-6DBP) Liver-enriched inhibitory protein (LIP) Liver-enriched transcriptional activator (LAP) Silencer factor B (SF-B)

Cleaved into:

GeneID:

Gene names  (primary ):Cebpb

Gene names  (synonym ):Crp2, Nf-il6 1 Publication, Sfb

Gene names  (ORF ):

Length:297

Mass:31,503

Sequence:MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC

Tissue specificity:Liver and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp