CBX7_MOUSE Q8VDS3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VDS3
Recommended name：Chromobox protein homolog 7
EC number：
Alternative names：
Cleaved into：
GeneID：52609
Gene names (primary )：Cbx7
Gene names (synonym )：D15Ertd417e
Gene names (ORF )：
Length：158
Mass：18109
Sequence：MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL
Tissue specificity：Expressed in embryonic stem cells. {ECO:0000269|PubMed:16537902, ECO:0000269|PubMed:22226355}.
Induction：
Developmental stage：In embryonic fibroblast cultured in vitro, expression gradually decreases with passage number and totally disappears in senescent cells.
Protein families：