KPCZ_MOUSE   Q02956


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02956

Recommended name:Protein kinase C zeta type

EC number:EC 2.7.11.13

Alternative names:(nPKC-zeta)

Cleaved into:

GeneID:18762

Gene names  (primary ):Prkcz

Gene names  (synonym ):Pkcz

Gene names  (ORF ):

Length:592

Mass:67682

Sequence:MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV

Tissue specificity:Isoform 1: In brain, highly expressed in cerebellar granule neurons and cerebellar astrocytes (at protein level) (PubMed:1487145, PubMed:12932816). Expressed at low levels in testes, lung and kidney (PubMed:1487145, PubMed:23283171). Isoform 2: Specifically expressed in brain where it localizes to cerebellar granule neurons (at protein level) (PubMed:12932816, PubMed:23283171). {ECO:0000269|PubMed:12932816, ECO:0000269|PubMed:1487145, ECO:0000269|PubMed:23283171}.

Induction:[Isoform 2]: Induced during synaptic long term potentiation. {ECO:0000269|PubMed:27187150}.

Developmental stage:

Protein families:Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily


   💬 WhatsApp