KPCZ_MOUSE Q02956
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02956
Recommended name:Protein kinase C zeta type
EC number:EC 2.7.11.13
Alternative names:(nPKC-zeta)
Cleaved into:
GeneID:18762
Gene names (primary ):Prkcz
Gene names (synonym ):Pkcz
Gene names (ORF ):
Length:592
Mass:67682
Sequence:MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
Tissue specificity:Isoform 1: In brain, highly expressed in cerebellar granule neurons and cerebellar astrocytes (at protein level) (PubMed:1487145, PubMed:12932816). Expressed at low levels in testes, lung and kidney (PubMed:1487145, PubMed:23283171). Isoform 2: Specifically expressed in brain where it localizes to cerebellar granule neurons (at protein level) (PubMed:12932816, PubMed:23283171). {ECO:0000269|PubMed:12932816, ECO:0000269|PubMed:1487145, ECO:0000269|PubMed:23283171}.
Induction:[Isoform 2]: Induced during synaptic long term potentiation. {ECO:0000269|PubMed:27187150}.
Developmental stage:
Protein families:Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily