ATP5I_MOUSE   Q06185


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q06185

Recommended name:ATP synthase subunit e, mitochondrial

EC number:

Alternative names:(ATPase subunit e) (ATP synthase membrane subunit e)

Cleaved into:

GeneID:11958

Gene names  (primary ):Atp5me

Gene names  (synonym ):Atp5i Atp5k Lfm-1 Lfm1

Gene names  (ORF ):

Length:71

Mass:8236

Sequence:MVPPVQVSPLIKFGRYSALIIGMAYGAKRYSYLKPRAEEERRIAAEEKKRLDELKRIERELAEAQDDSILK

Tissue specificity:Mammary gland, liver, kidney, heart, spleen, brain and lung.

Induction:

Developmental stage:

Protein families:ATPase e subunit family


   💬 WhatsApp