CP4X1_RAT Q8K4D6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4D6
Recommended name：Cytochrome P450 4X1 1 Publication
EC number：EC:1.14.14.-
Alternative names：CYPIVX1
Cleaved into：
GeneID：246767
Gene names (primary )：Cyp4x1 1 Publication
Gene names (synonym )：
Gene names (ORF )：
Length：507
Mass：58,574
Sequence：MEASWLENRWARPLHLALVFCLALVLMQAVKLYLRRQRLLRDLRPFPGPTAHWLLGHQKFLQEDNMEKLDEIVKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQLMTPFLGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQCTEKIIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFSDADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLDEIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKDPKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVAADLTRPPAFSSHTVLRPKHGIYLHLKKLPEC
Tissue specificity：Expressed at high levels in brain, mainly in neurons in different regions, including brain stem, hippocampus, cortex and cerebellum. Also expressed in cerebral vasculature. Not detected in kidney, nor liver. 1
Induction：
Developmental stage：
Protein families：