MLN_MOUSE Q9CV60
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CV60
Recommended name：Myoregulin
EC number：
Alternative names：
Cleaved into：
GeneID：69563
Gene names (primary )：Mrln
Gene names (synonym )：Mln
Gene names (ORF )：
Length：46
Mass：5175
Sequence：MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS
Tissue specificity：Specifically expressed in all skeletal muscles. Not expressed in cardiac or smooth muscles. {ECO:0000269|PubMed:25640239}.
Induction：Expression is regulated by MYEF2 and MYOD1. {ECO:0000269|PubMed:25640239}.
Developmental stage：During embryogenesis, expressed in the myotomal compartment of the somites and the anlagen of skeletal muscle. During fetal and adult stages, strongly expressed in all skeletal muscles. Not detectable in cardiac or smooth muscles. {ECO:0000269|PubMed:25640239}.
Protein families：