TFEC_RAT   Q63302


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63302

Recommended name:Transcription factor EC

EC number:

Alternative names:

Cleaved into:

GeneID:26296

Gene names  (primary ):Tfec

Gene names  (synonym ):Tcfec

Gene names  (ORF ):

Length:317

Mass:35,175

Sequence:MTLDHRLFSQTLKRAQPLAASCMPLAEHGPRSPDSDAGCAGNPFTNPLALGKEDGVVEWRLSGSILDVYSGEQGISPVNTGLMNASCPSILPMKKEIAETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDIRWNKGTILKASVDYIKWLQKEQQRARELEHRQKKLEHANRQLMLRIQELEIQARAHGLPILASLGTADFGTHITKQQTHSEKNSVGCCQQLTPSQGTSPEFYEQAVAFSDPLSHFTDLSFSAALKEEQRLDGMLLSDTICPFGTDPLLSAISPAVSKASSRSSLSSEDGDEL

Tissue specificity:Expressed in kidney, spleen, lung, liver, testis and muscle. 1

Induction:

Developmental stage:Expressed in embryo at 14 dpc and in skeletal muscle at 18 dpc. 1

Protein families:


   💬 WhatsApp