CIP1_MOUSE D3Z3K2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3Z3K2
Recommended name：E3 ubiquitin-protein ligase CCNB1IP1
EC number：EC 2.3.2.27
Alternative names：(Cyclin-B1-interacting protein 1) (RING-type E3 ubiquitin transferase CCNB1IP1)
Cleaved into：
GeneID：239083
Gene names (primary )：Ccnb1ip1
Gene names (synonym )：Gm288 Hei10 Mei4
Gene names (ORF )：
Length：276
Mass：31386
Sequence：MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEVVLDISSRALAFWTYQVHQERLYQEYNFSKAENHLKQMEKMYMQQIQSKNIELTSMKGEVISMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIASQEGSLEPGMIPQSGVFGFPPGNNSKFSLDHIPVGNQGGGDEDVQFRPFFVCSPTAPEPINNFFSFASPSHEAEQQVCSRAFKAKRI
Tissue specificity：Expressed predominantly in the testes and 17 day embryos (corresponding to prophase I in females). Weakly or not expressed in other tissues. {ECO:0000269|PubMed:17784788}.
Induction：
Developmental stage：In spermatocytes, synaptonemal complex-associated Ccnb1ip1 foci are detected by early pachynema and their number peaks during midpachynema. In late-pachytene nuclei, Ccnb1ip1 foci number descrease. At the onset of diplonema, foci are no longer detected (at protein level). {ECO:0000269|PubMed:21779533, ECO:0000269|PubMed:24390283}.
Protein families：