PKHB2_MOUSE Q9QZC7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZC7
Recommended name：Pleckstrin homology domain-containing family B member 2
EC number：
Alternative names：(PH domain-containing family B member 2) (Evectin-2)
Cleaved into：
GeneID：226971
Gene names (primary )：Plekhb2
Gene names (synonym )：Evt2
Gene names (ORF )：
Length：221
Mass：24574
Sequence：MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAILSEETAVAASPPPYAAYATPTPEVYGYGPYSGAYPAGTQVVYAANGQAYAVPYQYPYAGVYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
Tissue specificity：Highly expressed in brain, retina, heart and kidney. Detected at lower levels in lung, muscle and nerve. {ECO:0000269|PubMed:10200314}.
Induction：
Developmental stage：Highly expressed at birth and up to day 3; expressed at lower levels in embryo and adult.
Protein families：