HSPB8_MOUSE Q9JK92
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK92
Recommended name：Heat shock protein beta-8
EC number：
Alternative names：(HspB8) (Alpha-crystallin C chain) (Small stress protein-like protein HSP22)
Cleaved into：
GeneID：80888
Gene names (primary )：Hspb8
Gene names (synonym )：Cryac Hsp22
Gene names (ORF )：
Length：196
Mass：21533
Sequence：MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPPATARFGVPAEGRSPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPATVFASLSPEGLLIIEAPQVPPYSPFGESSFNNELPQDNQEVTCS
Tissue specificity：Highly expressed in skeletal muscle, heart, uterus, liver, lung and ovary. Low levels found in stomach and brain. Not detected in small intestine, large intestine, kidney, spleen and testis. In the ovary, expression is concentrated in the endometrium and in the connective tissue between the circular and longitudinal muscles of the myometrium. {ECO:0000269|PubMed:11133685}.
Induction：By progesterone. {ECO:0000269|PubMed:11133685}.
Developmental stage：Detected in developing heart throughout embryonic development but only detected in developing liver close to time of birth. In the adult ovary, expression is highest during decidualization and early pregnancy. {ECO:0000269|PubMed:11133685}.
Protein families：Small heat shock protein (HSP20) family