KLK4_MOUSE Q9Z0M1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0M1
Recommended name：Kallikrein-4
EC number：EC 3.4.21.-
Alternative names：(Enamel matrix serine proteinase 1) (Kallikrein-like protein 1) (Serine protease 17)
Cleaved into：
GeneID：56640
Gene names (primary )：Klk4
Gene names (synonym )：EMSP1 KLK-L1 Prss17
Gene names (ORF )：
Length：255
Mass：27488
Sequence：MMVTARTPWGWFLGCLILEVTGASASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWGQLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN
Tissue specificity：
Induction：
Developmental stage：In developing teeth, expressed in ameloblasts during transition and maturation stages (PubMed:10863090, PubMed:10690663, PubMed:19578120). Expressed weakly in odontoblasts (PubMed:10863090). Not detected in odontoblasts (PubMed:19578120). Detected in the epithelium surrounding the erupted first molar (PubMed:10690663). {ECO:0000269|PubMed:10690663, ECO:0000269|PubMed:10863090, ECO:0000269|PubMed:19578120}.
Protein families：Peptidase S1 family, Kallikrein subfamily