UQCC1_MOUSE Q9CWU6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CWU6
Recommended name：Ubiquinol-cytochrome-c reductase complex assembly factor 1
EC number：
Alternative names：(Basic FGF-repressed Zic-binding protein) (mbFZb) (Ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog)
Cleaved into：
GeneID：56046
Gene names (primary )：Uqcc1
Gene names (synonym )：Bfzb Uqcc
Gene names (ORF )：
Length：295
Mass：34300
Sequence：MALLVRVLRNQTSISQWVPVCSQLVSVSPTQRQWSSTSQWLQKNQSRVCLGSEQTVGADTAQNRKYHNTSKLLTTQDFPQPVEEKVGPFTKIIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMGVNSYILKKNMALMTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQMQYLDSMNGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL
Tissue specificity：In the brain it is restricted to the olfactory bulb, the hippocampus, the piriform cortex and the Purkinje cells. {ECO:0000269|PubMed:11118897}.
Induction：Repressed by bFGF; in embryonic stem cells. {ECO:0000269|PubMed:11118897}.
Developmental stage：Expressed mainly in the developing nervous system from 9.5 dpc onwards. Also detected in the developing eye and the brown fat. {ECO:0000269|PubMed:11118897}.
Protein families：CBP3 family