GROA_MOUSE   P12850


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P12850

Recommended name:Growth-regulated alpha protein

EC number:

Alternative names:(C-X-C motif chemokine 1) (Platelet-derived growth factor-inducible protein KC) (Secretory protein N51)

Cleaved into:KC(5-72) (Hematopoietic synergistic factor) (HSF) (KC-T)

GeneID:14825

Gene names  (primary ):Cxcl1

Gene names  (synonym ):Gro Gro1 Mgsa Scyb1

Gene names  (ORF ):

Length:96

Mass:10254

Sequence:MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Tissue specificity:

Induction:By platelet-derived growth factor. In lung, by lipopolysaccharide or inflammation (By similarity). {ECO:0000250}.

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp