CBR2_MOUSE P08074
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08074
Recommended name：Carbonyl reductase [NADPH] 2
EC number：EC 1.1.1.184
Alternative names：(Adipocyte protein P27) (AP27) (Lung carbonyl reductase) (LCR) (NADPH-dependent carbonyl reductase 2)
Cleaved into：
GeneID：12409
Gene names (primary )：Cbr2
Gene names (synonym )：
Gene names (ORF )：
Length：244
Mass：25958
Sequence：MKLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Tissue specificity：Lung (ciliated cells, non-ciliated bronchiolar cells and type-II alveolar pneumocytes). Low expression in adipose tissue > testis = heart > kidney = spleen > brain = liver.
Induction：By glucocorticoids. Activated by fatty acids.
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family