IF2H_RAT C9WPN6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:C9WPN6
Recommended name：Eukaryotic translation initiation factor 2 subunit 3, Y-linked
EC number：EC:3.6.5.3
Alternative names：Eukaryotic translation initiation factor 2 subunit gamma, Y-linked (eIF-2-gamma Y)
Cleaved into：
GeneID：100312984
Gene names (primary )：Eif2s3y
Gene names (synonym )：
Gene names (ORF )：
Length：472
Mass：51,154
Sequence：MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSHEIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDSSCPRPECYRSCGSSTPDEFPSDIPGIKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPLRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTIDDE
Tissue specificity：Widely expressed in males. 1
Induction：
Developmental stage：
Protein families：