CDCA4_MOUSE   Q9CWM2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWM2

Recommended name:Cell division cycle-associated protein 4

EC number:

Alternative names:(Hematopoietic progenitor protein)

Cleaved into:

GeneID:71963

Gene names  (primary ):Cdca4

Gene names  (synonym ):Hepp

Gene names  (ORF ):

Length:237

Mass:26107

Sequence:MFARGLKRKYGDQEEGVEGFGTVPSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMSQDGVWHGMAPQNVDRAPVERLVSTEILCRTVRGAEEEHPAPELEDAPLQNSVSELPIVGSAPGQRNPQSSLWEMDSPQENRGSFQKSLDQIFETLENKNSSSVEELFSDVDSSYYDLDTVLTGMMSGTKSSLCNGLEGFAAATPPPSSTCKSDLAELDHVVEILVET

Tissue specificity:Expressed preferentially in hematopoietic progenitors and mature blood cells. Expressed at low levels in the heart, lung, spleen, and thymus and at a higher level in muscle.

Induction:

Developmental stage:Developmentally regulated. Preferential expression in both fetal and adult hematopoietic progenitors and mature blood cells during embryonic and adult hematopoiesis.

Protein families:


   💬 WhatsApp