PA2G5_MOUSE P97391
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97391
Recommended name:Phospholipase A2 group V
EC number:EC 3.1.1.4
Alternative names:(PLA2-10) (Phosphatidylcholine 2-acylhydrolase 5)
Cleaved into:
GeneID:18784
Gene names (primary ):Pla2g5
Gene names (synonym ):
Gene names (ORF ):
Length:137
Mass:15859
Sequence:MKGLLTLAWFLACSVPAVPGGLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC
Tissue specificity:Expressed in peritoneal macrophages (at protein level) (PubMed:16407308). Expressed in heart, skeletal muscle and white adipose tissue (PubMed:24910243). {ECO:0000269|PubMed:16407308, ECO:0000269|PubMed:24910243}.
Induction:Up-regulated in white adipocytes upon high-fat diet. {ECO:0000269|PubMed:24910243}.
Developmental stage:
Protein families:Phospholipase A2 family