OLR1_RAT O70156
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70156
Recommended name：Oxidized low-density lipoprotein receptor 1
EC number：
Alternative names：Lectin-like oxidized LDL receptor 1 (LOX-1; Lectin-like oxLDL receptor 1) Lectin-type oxidized LDL receptor 1
Cleaved into：
GeneID：140914
Gene names (primary )：Olr1
Gene names (synonym )：Lox1, Oldlr1
Gene names (ORF )：
Length：364
Mass：41,890
Sequence：MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ
Tissue specificity：Predominantly expressed in lung and at lower level in kidney. Expressed in macrophages but not in vascular smooth muscle cells. 1
Induction：
Developmental stage：By hypertension. Up-regulated by shear stress, lipopolysaccharide and TNF-alpha in cultured vascular endothelial cells. 2 s
Protein families：