RFX2_RAT B2GV50
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B2GV50
Recommended name：DNA-binding protein RFX2
EC number：
Alternative names：
Cleaved into：
GeneID：301121
Gene names (primary )：Rfx2
Gene names (synonym )：
Gene names (ORF )：
Length：692
Mass：76,537
Sequence：MQNSEGGADSPATVALRPAAQPVPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQHVYPAQVQYVEGGDAVYANGAIRAAYTYNPDPQLYAPSSAASYFETPGGAQVTVAASSPPAVPSHGMVGITMDVSGTPIVSGAGTYLIHGGMDSTRHSLAHTARSSPATLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLGDGSAHSNMHSTPEQAMAAQGQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQLVYRRHCEATLDVVMNLQFQYIEKLWLSFWNCKATSSDGRASLPASDEEPEVTLLPKDKLISLCKCEPILQWMRSCDHILYQALVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINAMSGFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESLVQRLEHDFKVTLQQQSSLDQWASWLDNVVTQVLKQHAGSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMGEFNDLASLSLTLLDKEDIGDGHSSEADVDGRSLGEPLVKRERSDPSHPLQGI
Tissue specificity：Expressed at highest level in testis. Expressed at lower level in thymus. Also expressed in stomach, kidney, liver, brain and heart. Weakly expressed in spleen and lung (PubMed:16676351). Within testis, most abundantly present in spermatocytes: present from pachytene spermatocytes to early spermatids (at protein level) (PubMed:15229132, PubMed:16676351). Also present in non-germinal tissues (PubMed:16676351). 2 s
Induction：
Developmental stage：
Protein families：