SH3Y1_MOUSE O08641
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08641
Recommended name:SH3 domain-containing YSC84-like protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:24057
Gene names (primary ):Sh3yl1
Gene names (synonym ):
Gene names (ORF ):
Length:340
Mass:37028
Sequence:MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAVLSVIKAGFLVTARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNFTVAVGPLGRNLEGNVSLRSSAAVFTYCKSRGLFAGISLEGSCLIERKETNRKFYCQDIRAYDILFGDVPQPAQAEDLYEILNSFTEKYETEGQRINLKKVAREQRKAKELPPKPSSRPQPAHPPVQLNAGSQGNRNEYKLYPELSSYHEKTGNLNQPIEVTALYSFEGQQPGDLNFQAGDRIIVISKTDSNFDWWEGKLRGQTGIFPANYVTMN
Tissue specificity:Expressed in skin, kidney, stomach, small intestine and colon. Highly expressed in the anagen hair follicle. In hair, it is expressed predominantly in the hair bulb, the hair shaft, inner root sheath, and outer root sheath in the lower half of the follicle. {ECO:0000269|PubMed:10771491}.
Induction:
Developmental stage:In skin, expression follows hair-growth cycle, increasing significantly during mid and late anagen phases, and decreases during catagen, telogen and early anagen phases. {ECO:0000269|PubMed:10771491}.
Protein families:SH3YL1 family