MRGRF_RAT   P23749


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P23749

Recommended name:Mas-related G-protein coupled receptor member F

EC number:

Alternative names:G-protein coupled receptor RTA

Cleaved into:

GeneID:266762

Gene names  (primary ):Mrgprf

Gene names  (synonym ):Mrgf, Rta

Gene names  (ORF ):

Length:343

Mass:38,364

Sequence:MAGNCSWEAHSTNQNKMCPGMSEALELYSRGFLTIEQIATLPPPAVTNYIFLLLCLCGLVGNGLVLWFFGFSIKRTPFSIYFLHLASADGIYLFSKAVIALLNMGTFLGSFPDYVRRVSRIVGLCTFFAGVSLLPAISIERCVSVIFPMWYWRRRPKRLSAGVCALLWLLSFLVTSIHNYFCMFLGHEASGTACLNMDISLGILLFFLFCPLMVLPCLALILHVECRARRRQRSAKLNHVVLAIVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAEPGDAASSTPNTVTMEMQCPSGNAS

Tissue specificity:Gut, vas deferens, uterus and aorta; barely detectable in liver, kidney, lung, and salivary gland. In the brain, markedly abundant in the cerebellum.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp