PA2GX_MOUSE   Q9QXX3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXX3

Recommended name:Group 10 secretory phospholipase A2

EC number:EC 3.1.1.4

Alternative names:(Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)

Cleaved into:

GeneID:26565

Gene names  (primary ):Pla2g10

Gene names  (synonym ):

Gene names  (ORF ):

Length:151

Mass:17005

Sequence:MLLLLLLLLLGPGPGFSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN

Tissue specificity:Expressed at high levels in testis and the gastrointestinal tract including stomach and colon. Expressed at lower levels in other tissues including small intestine, uterus, oviduct, lung, thymus, spleen and brain (PubMed:11019817, PubMed:21266581). Expressed in Paneth-like secretory epithelial cells of the colon (PubMed:27292189). Expressed in gastric and ileac epithelial cells and in glandular epithelium of intestinal mucosa (at protein level) (PubMed:21266581). Expressed in late spermatogenic cells, spermatocytes and spermatids, but not spermatogonia in seminiferous tubules (at protein level) (PubMed:20424324). Expressed mainly in the apical side of endometrial epithelial cells and in the interstitium beneath the epithelium of uterus (at protein level) (PubMed:21266581). Expressed in resident spleen macrophages (at protein level) (PubMed:11019817). Expressed at outermost layer of hair follicles (PubMed:21266583). Expressed in dorsal root ganglia in both NEFH-positive A-fibers and PRPH-positive C-fibers (at protein level) (PubMed:21266581). {ECO:0000269|PubMed:11019817, ECO:0000269|PubMed:20424324, ECO:0000269|PubMed:21266581, ECO:0000269|PubMed:21266583, ECO:0000269|PubMed:27292189}.

Induction:Up-regulated in alveolar macrophages upon allergen-induced airway inflammation (PubMed:17403936). Up-regulated in bronchoalveolar lavage fluid (BALF) in response to house dust mite proteolytic allergens (PubMed:29093264). {ECO:0000269|PubMed:17403936, ECO:0000269|PubMed:29093264}.

Developmental stage:During hair follicle growth cycle, it is detected at low levels at 17.5 dpc (hair folliculogenesis stage), increases to a maximum expression level by P10 (anagen), declines to the basal level at P15-20 (catagen to telogen), and again increases at P25 (re-entry into the next anagen). {ECO:0000269|PubMed:21266583}.

Protein families:Phospholipase A2 family


   💬 WhatsApp