HOATZ_MOUSE Q80Y73
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80Y73
Recommended name：Cilia- and flagella-associated protein HOATZ
EC number：
Alternative names：
Cleaved into：
GeneID：235345
Gene names (primary )：Hoatz
Gene names (synonym )：Hoatzin
Gene names (ORF )：
Length：168
Mass：19068
Sequence：METGPRGCPSGRKESQEICSPGLLVFTGCSEQDANLAKQFWLGASMYPTTESQLVLTRGSSQRLPVARNSKVVLREKSSVQPFPFDQDKDAIIFAKAQRIQESEERAKYLQKAKTRDEILQLLRKQREERISKELISLPYKPKDKVPKSKEVLSESGLRDQEEVKALE
Tissue specificity：Specifically expressed in tissues with motile cilia and flagella, such as brain ependyma, lung, testis, and oviduct but not in whole brain, liver,kidney, spleen, and eyeball. {ECO:0000269|PubMed:32248064}.
Induction：
Developmental stage：Detected as early as postnatal day 15 (P15), and then continually increased during the first 45 days. {ECO:0000269|PubMed:32248064}.
Protein families：HOATZ family