MSMO1_RAT   O35532


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35532

Recommended name:Methylsterol monooxygenase 1

EC number:EC:1.14.18.9

Alternative names:C-4 methylsterol oxidase Neuropep 1 RANP-1 Sterol-C4-methyl oxidase

Cleaved into:

GeneID:140910

Gene names  (primary ):Msmo1

Gene names  (synonym ):Sc4mol

Gene names  (ORF ):

Length:293

Mass:34,964

Sequence:MAMNKSVGLFSSASLAVDYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHETIYFLFSLPGFLFQFIPFMRKYKIQKDKPETFEGQWKCLKGILFNHFFIQLPLICGTYYFTEFFNIPYDWERMPRWYFTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTMRLLETIDVHSGYDIPLNPLNYIPFYTGARHHDFHHMNFIGNYASTFTWWDRIFGTDVQYHAYTEKMKKLGKKSE

Tissue specificity:

Induction:

Developmental stage:

Protein families:sterol desaturase family


   💬 WhatsApp