ADIG_MOUSE Q8R400
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R400
Recommended name：Adipogenin
EC number：
Alternative names：(Small adipocyte factor 1) (SMAF-1)
Cleaved into：
GeneID：246747
Gene names (primary )：Adig
Gene names (synonym )：Smaf1
Gene names (ORF )：
Length：80
Mass：9362
Sequence：MKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIVWLHFLLSQESKEDDSDLCFNWEPWSKRPSECGCEETFPGEEDGLHW
Tissue specificity：Selectively expressed in adipose tissue where it is particularly enriched in brown adipose tissue. In adipose tissue, expressed exclusively in adipocytes and not in the stromal-vascular cell population. Expressed at much lower levels in heart, stomach and muscle and barely detected in kidney and lung. {ECO:0000269|PubMed:15567149, ECO:0000269|PubMed:16132694}.
Induction：Induced during adipose conversion of 3T3-L1 cells. Up-regulated in 3T3-L1 adipocytes by troglitazone which stimulates PPARG expression during differentiation. Down-regulated in 3T3-L1 adipocytes exposed to TNF-alpha and to retinoic acid. {ECO:0000269|PubMed:15567149, ECO:0000269|PubMed:16132694}.
Developmental stage：
Protein families：Adipogenin family