RAB32_MOUSE Q9CZE3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CZE3
Recommended name：Ras-related protein Rab-32
EC number：
Alternative names：
Cleaved into：
GeneID：67844
Gene names (primary )：Rab32
Gene names (synonym )：
Gene names (ORF )：
Length：223
Mass：25068
Sequence：MAGEGLGQQGASATAAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENMLANQQSFPSEEIDLDRIKLVEEPPTTKPRSQCC
Tissue specificity：Widely expressed with highest levels in liver. Strong expression also found in melanocyte, platelet, mast cell and fibroblast cell lines. {ECO:0000269|PubMed:14499590}.
Induction：
Developmental stage：In the embryo, highest levels occur at day 7. {ECO:0000269|PubMed:14499590}.
Protein families：Small GTPase superfamily, Rab family