S2541_RAT B8ZHC9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B8ZHC9
Recommended name：Calcium-independent mitochondrial carrier protein SCaMC-3L Curated
EC number：
Alternative names：
Cleaved into：
GeneID：301114
Gene names (primary )：Slc25a41
Gene names (synonym )：rCG_45007 Imported
Gene names (ORF )：
Length：312
Mass：34,557
Sequence：MGVHLEVLDTGEQLMVPGDVLEEENKGTLWKFLLSGAMAGAVSRTGTAPLDRARVYMQVYSSKSNFRHLLSGLRSLVQEGGIRSLWRGNGINVLKIAPEYAIKFSVFEQSRNFFYGVHTSPSFQERVVAGSLAVAISQTLINPMEVLKTRLTLRFTGQYKGLLDCARQILERDGTRALYRGYLPNMLGIIPYACTDLAVYELLRCLWQKSGRDMKDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMLGVFKRILNQQGWPGLYRGMTPTLLKVLPAGGISYLVYEAMKKTLGVQVLSR
Tissue specificity：Mainly expressed in testis and at lesser levels in brain. 1
Induction：
Developmental stage：
Protein families：