PGRP1_RAT   Q9JLN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JLN4

Recommended name:Peptidoglycan recognition protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:84387

Gene names  (primary ):Pglyrp1

Gene names  (synonym ):Pglyrp, Pgrp

Gene names  (ORF ):

Length:183

Mass:20,591

Sequence:MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE

Tissue specificity:Expressed in all regions of the brain.

Induction:

Developmental stage:By sleep deprivation in the brain stem and in the hypothalamus.

Protein families:


   💬 WhatsApp