CRF_MOUSE   Q8CIT0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CIT0

Recommended name:Corticoliberin

EC number:

Alternative names:(Corticotropin-releasing factor) (CRF) (Corticotropin-releasing hormone)

Cleaved into:

GeneID:12918

Gene names  (primary ):Crh

Gene names  (synonym ):Gm1347

Gene names  (ORF ):

Length:187

Mass:20778

Sequence:MRLRLLVSAGMLLVALSSCLPCRALLSRGSVPRAPRAPQPLNFLQPEQPQQPQPVLIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRSLDSRAEPAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Tissue specificity:Expressed in parvocellular paraventricular nucleus of the hypothalamus and in medial accessory olivary nucleus. {ECO:0000269|PubMed:19912808}.

Induction:Up-regulated during water-avoidance stress. {ECO:0000269|PubMed:23470617}.

Developmental stage:

Protein families:Sauvagine/corticotropin-releasing factor/urotensin I family


   💬 WhatsApp