CRF_MOUSE Q8CIT0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CIT0
Recommended name：Corticoliberin
EC number：
Alternative names：(Corticotropin-releasing factor) (CRF) (Corticotropin-releasing hormone)
Cleaved into：
GeneID：12918
Gene names (primary )：Crh
Gene names (synonym )：Gm1347
Gene names (ORF )：
Length：187
Mass：20778
Sequence：MRLRLLVSAGMLLVALSSCLPCRALLSRGSVPRAPRAPQPLNFLQPEQPQQPQPVLIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRSLDSRAEPAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Tissue specificity：Expressed in parvocellular paraventricular nucleus of the hypothalamus and in medial accessory olivary nucleus. {ECO:0000269|PubMed:19912808}.
Induction：Up-regulated during water-avoidance stress. {ECO:0000269|PubMed:23470617}.
Developmental stage：
Protein families：Sauvagine/corticotropin-releasing factor/urotensin I family