SPA3N_MOUSE   Q91WP6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WP6

Recommended name:Serine protease inhibitor A3N

EC number:

Alternative names:(Serpin A3N)

Cleaved into:

GeneID:

Gene names  (primary ):Serpina3n

Gene names  (synonym ):Spi2

Gene names  (ORF ):

Length:418

Mass:46718

Sequence:MAFIAALGLLMAGICPAVLCFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Tissue specificity:Expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle. {ECO:0000269|PubMed:15638460, ECO:0000269|PubMed:1718822}.

Induction:Expression is induced by bacterial lipopolysaccharide (LPS). {ECO:0000269|PubMed:1718822}.

Developmental stage:

Protein families:Serpin family


   💬 WhatsApp