HSF2B_MOUSE Q9D4G2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D4G2
Recommended name：Heat shock factor 2-binding protein
EC number：
Alternative names：
Cleaved into：
GeneID：74377
Gene names (primary )：Hsf2bp
Gene names (synonym )：Meilb2
Gene names (ORF )：
Length：338
Mass：37963
Sequence：MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQKLKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQAEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVDSDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMSLYNVSINSKGLKYITESPGFIPLLWWLLSDPDAEVCLHTLRLIQSVVLEPDVFSKVASELQSSLPLQRILAMSKSRNSHLQSAAQELLEDLRALDCNV
Tissue specificity：Expressed in testis and, to a lesser extent, in lung and muscle. {ECO:0000269|PubMed:23707421, ECO:0000269|PubMed:32345962, ECO:0000269|PubMed:32460033}.
Induction：
Developmental stage：Detected at low levels from birth to 3 days post partum, thereafter the expression level increases from 5 days post partum to adult. In spermatocytes, shows punctate localization along chromosome axes specifically in early meiotic prophase I cells. Foci start to appear from the leptotene stage, reach their greatest number in the zygotene stage, persist until the early pachytene stage, and finally disappear in the late pachytene stage (PubMed:30760716). {ECO:0000269|PubMed:23707421, ECO:0000269|PubMed:30760716}.
Protein families：