SLUR1_MOUSE   Q9Z0K7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z0K7

Recommended name:Secreted Ly-6/uPAR-related protein 1

EC number:

Alternative names:(SLURP-1) (ARS component B)

Cleaved into:

GeneID:57277

Gene names  (primary ):Slurp1

Gene names  (synonym ):Ars

Gene names  (ORF ):

Length:110

Mass:12016

Sequence:MTLRWAMWLLLLAAWSMGYGEAFRCYTCEQPTAINSCKNIAQCKMEDTACKTVLETVEAAFPFNHSPMVTRSCSSSCLATDPDGIGVAHPVFCCFRDLCNSGFPGFVAGL

Tissue specificity:Expressed in skin, eye, whole lung, trachea, esophagus and stomach (PubMed:14721776). Widely expressed in various tissues including spleen and thymus but not pancreas. Expressed in macrophages, dendritic cells, T and B cells (PubMed:17286989). Expressed in lung specifically in ciliated bronchial epithelial cells (at protein level). Expression is decreased in lungs of asthmatic model mice(PubMed:19396877, PubMed:20621062). Expressed in the cornea (PubMed:23139280). {ECO:0000269|PubMed:14721776, ECO:0000269|PubMed:17286989, ECO:0000269|PubMed:19396877, ECO:0000269|PubMed:20621062, ECO:0000269|PubMed:23139280}.

Induction:Down-regulated in the cornea under proinflammatory conditions. {ECO:0000269|PubMed:23139280}.

Developmental stage:

Protein families:


   💬 WhatsApp