CCNA2_MOUSE P51943
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51943
Recommended name：Cyclin-A2
EC number：
Alternative names：(Cyclin-A)
Cleaved into：
GeneID：12428
Gene names (primary )：Ccna2
Gene names (synonym )：Ccna Cyca Cyca2
Gene names (ORF )：
Length：422
Mass：47269
Sequence：MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV
Tissue specificity：Ubiquitous (PubMed:8565853). In the testis, expressed in germ cells and in the ovary, in both germline and somatic cells (PubMed:8575639, PubMed:10068472). {ECO:0000269|PubMed:10068472, ECO:0000269|PubMed:8565853, ECO:0000269|PubMed:8575639}.
Induction：
Developmental stage：Accumulates steadily during G2 and is abruptly destroyed at mitosis. Expressed in spermatogonia and is most abundant in preleptotene spermatocytes, cells which will enter the meiotic pathway. {ECO:0000269|PubMed:10068472, ECO:0000269|PubMed:8565853, ECO:0000269|PubMed:8575639}.
Protein families：Cyclin family, Cyclin AB subfamily