DJB13_MOUSE Q80Y75
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80Y75
Recommended name：DnaJ homolog subfamily B member 13
EC number：
Alternative names：(Testis and spermatogenesis cell-related protein 6) (Testis spermatocyte apoptosis-related gene 6 protein) (Testis spermatogenesis apoptosis-related gene 3 protein) (Testis spermatogenesis apoptosis-related gene 6 protein)
Cleaved into：
GeneID：69387
Gene names (primary )：Dnajb13
Gene names (synonym )：Tsarg Tsarg3 Tsarg6
Gene names (ORF )：
Length：316
Mass：36155
Sequence：MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT
Tissue specificity：Expressed in ciliated cell-containing tissues such as testis, brain, lung, ovary and oviduct. {ECO:0000269|PubMed:14673507, ECO:0000269|PubMed:19919626, ECO:0000269|PubMed:29298896}.
Induction：
Developmental stage：Expressed during spermiogenesis. {ECO:0000269|PubMed:29298896}.
Protein families：