MTURN_MOUSE Q8CGA4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CGA4
Recommended name:Maturin
EC number:
Alternative names:(Maturin neural progenitor differentiation regulator protein homolog)
Cleaved into:
GeneID:68235
Gene names (primary ):Mturn
Gene names (synonym ):
Gene names (ORF ):
Length:131
Mass:14841
Sequence:MDFQQLADVAEKWCSSTPFELIAAEETERRMDFYADPGVSFYVLCPDNGCGDSFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ
Tissue specificity:Expressed in the thymus, bone marrow and spleen. {ECO:0000269|PubMed:24681962}.
Induction:
Developmental stage:Expressed in embryo throughout the early nervous system. Strongly expressed in differentiating neurons in the brain, spinal cord and retina. Not detected in the lens at any developmental stage tested. {ECO:0000269|PubMed:24095902}.
Protein families:MTURN family