CALCB_MOUSE   Q99MP3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MP3

Recommended name:Calcitonin gene-related peptide 2

EC number:

Alternative names:(Beta-type CGRP) (Calcitonin gene-related peptide II) (CGRP-II)

Cleaved into:

GeneID:

Gene names  (primary ):Calcb

Gene names  (synonym ):

Gene names  (ORF ):

Length:130

Mass:14623

Sequence:MDFWKFFPFLALSTIWVLCLASSLQAAPFRSALESSLDLGTLGDQEKHLLLAALMQDYEQMKARKLEQEEQETKGSRVTAQKRSCNTATCVTHRLADLLSRSGGVLKDNFVPTDVGSEAFGRRRRRDLQA

Tissue specificity:Detected in nerve cells of cerebrum, hippocampus and pons/midbrain in newborns, and only in nerve cells of pons/midbrain in adult. {ECO:0000269|PubMed:18544925}.

Induction:

Developmental stage:

Protein families:Calcitonin family


   💬 WhatsApp